PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_12584
Common NameKK1_012970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 372aa    MW: 41710.8 Da    PI: 5.8166
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_12584genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.66e-33227282156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  C.cajan_12584 227 KQRRCWSPDLHRRFVDALQQLGGAQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 282
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.254224284IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-30225285IPR009057Homeodomain-like
SuperFamilySSF466895.83E-18225285IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-27227282IPR006447Myb domain, plants
PfamPF002492.2E-7229280IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDLSLDLTLG FVPQPISLFF PTKLDNHQTL ATLDAFVQRL EDELTKVQAF KRELPLSMLL  60
LNDAIARLRE EKVKCSGMQD QDPPINQEEF PPLENENEST EKKNWMSSAQ LWSTHKTKSV  120
ILISNCTILD FHLFYRIETR TVFLFFGLQW QRIDEEDDGN PVNGDSCVPK TEGSQVPRFN  180
LVTPASEPSH SNSKSVCGDN SGGSSLLRVE LQSQPQPPQH MQQNPRKQRR CWSPDLHRRF  240
VDALQQLGGA QVATPKQIRE LMQVDGLTND EVKSHLQKYR LHVRRFPVSS VGQGNNGSWM  300
GQDECGEKSK GNLSVSQTGS PQGPLTPLLL GGSVKGLSSP GRNSVDAEDE QSDCQNWKGG  360
FHHQLEPDNQ SL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150432e-75AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156835.11e-162hypothetical protein PHAVU_002G021400g
TrEMBLA0A151THY40.0A0A151THY4_CAJCA; Two-component response regulator ARR1
STRINGGLYMA11G06230.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-47G2-like family protein